Sign In | Join Free | My xpandrally.com
xpandrally.com
Products
Search by Category
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc dac 1295

    All cjc dac 1295 wholesalers & cjc dac 1295 manufacturers come from members. We doesn't provide cjc dac 1295 products or service, please contact them directly and verify their companies info carefully.

    Total 16786 products from cjc dac 1295 Manufactures & Suppliers
    Wholesale CJC -1295 Without DAC Peptide Hormones Muscle Building CAS 863288-34-0 from china suppliers

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:China

    ...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their action in the human...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale CJC1295 Without DAC High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial 863288-34-0 from china suppliers

    Brand Name:CJC-1295 Without DAC

    Model Number:863288-34-0

    Place of Origin:China

    ...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 from china suppliers

    Brand Name:Bodybuilding

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale White Powder Steroid Injections Peptide CJC 1295 Dac 2 Mg / Vial For Elderly from china suppliers

    Brand Name:HKYC

    Model Number:CJC1295 DAC

    Place of Origin:HUBEI,CHINA

    ... Sale Steroid Injections Cjc-1295 Dac Pure Peptides 2 Mg/ Vial Basic Info: Port: Guangzhou, China Production Capacity:500-1000kg/Month Payment Terms: T/T, Western Union, Money Gram, Bitcoin Model NO.: CJC1295 DAC Customized: Customized Suitable...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale Releasing Peptide Steroid Hormones Cjc -1295 Dac Injectable Lyophilized Powder from china suppliers

    Brand Name:JNJG

    Model Number:Cjc1295 Dac

    Place of Origin:CHINA

    ... guarantee! Delivery terms HKEMS,DHL,TNT,EMS,Fedex,UPS Payment Western Union, Money gram, T/T,Bitcoin CJC-1295 DAC

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Wholesale Human Growth Hormone Muscle Building Peptides CJC1295  / CJC1295 DAC from china suppliers

    Brand Name:YUANYANG

    Model Number:CAS: 863288-34-0

    Place of Origin:CHINA

    ...Top Grade Growth Hormone Peptide CJC1295 / CJC1295 DAC (2 mg/vial) Basic Details: Product Name: CJC1295 Alias: CJC1295 without DAC Density: 1.45 Type: Immune Function Agents Grade Classification: Brassinosteroid Purity (HPLC): 98.0% Appearance...

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale Bodybuilding Lyophilized Peptide CJC1295 with DAC for Muscle Enhance from china suppliers

    Brand Name:Pharmlab

    Model Number:863288-34-0

    Place of Origin:China

    ... Product name CJC-1295 with DAC Other name Cjc-1295,CJC-1295 with DAC CAS 863288-34-0 Molecular formula C152H252N44O42 Molecular weight 3367.2 Related substance 2.0% purity 98.0% Appearance White powder Description : CJC-1295 with DAC is Releasing Hormones...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Muscle Growth Growth Hormone Peptides CJC - 1295 DAC Lyophilized Peptide Powder from china suppliers

    Brand Name:BestSteroid

    Model Number:863288-34-0

    Place of Origin:Hubei,China

    ...Growth Hormone Peptides CJC-1295 With DAC 2mg For Bodybuilding CJC-1295 DAC Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale 99% purity HGH Peptide (CJC-1295 No DAC),CJC1295 Without DAC supplier, CJC-1295 Without DAC from china suppliers

    Brand Name:CJC1295 Without DAC

    Model Number:HGH

    Place of Origin:China

    ...: CJC-1295 without DAC 2mg/vial 1.product descroption: Product name: Cjc-1295 Without Dac Cjc-1295 Peptide CAS: 863288-34-0 Cjc-1295 Peptide Formula: C152H252N44O42 Cjc-1295 Peptide Molecular weight: 3367.2 Cjc-1295 Peptide purity: > 98.0% Cjc-1295 Peptide...

    Linyi dingsheng chemical products Co., Ltd
    Verified Supplier

    Shandong

    Wholesale 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac from china suppliers

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS Number 863288-34-0 Molecular...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale Bodybuilding Polypeptide Hormones CJC 1295 with DAC Muscle Enhancing Steroids from china suppliers

    Brand Name:Shanghai Stero

    Model Number:CJC 1295 DAC

    Place of Origin:China

    ...Bodybuilding Polypeptide Hormones CJC 1295 with DAC Muscle Enhancing Steroids Introduction: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body mass and ...

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Wholesale CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits from china suppliers

    Brand Name:Yvonne

    Model Number:863288-34-0

    Place of Origin:China

    ... available at any time; Prompt shipment after payment confirmed; Re-send policy; Door-to-Door CJC 1295 Quick Detail: Product Name CJC-1295 Without DAC Synonyms CJC-1295 Acetate;CJC-1295; CJC-1295 No DAC, CJC

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hubei

    Wholesale CJC-1295 Without DAC 2mg Lyophilized Peptide High Purity CJC-1295 No DAC from china suppliers

    Brand Name:steriodshow

    Model Number:CJC-1295 Without DAC (2mg/vial)

    Place of Origin:china manufactuer

    ...; Re-send policy; Door-to-Door; 5% discount for second same order. Quick Detail: Product Name CJC-1295 Without DAC Synonyms CJC-1295 Acetate;CJC-1295; CJC

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale Bodybuilding Human Growth Hormone Peptide Cjc 1295 with Dac CAS 863288-34-0 from china suppliers

    Brand Name:Biofriend

    Model Number:863288-34-0

    Place of Origin:Wuhan

    ...Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Bodybuilding peptide cjc 1295/cjc dac 1295 from china suppliers

    Categories:Human Growth Hormone Peptide

    Telephone:0755-36329806

    Country/Region:china

    ...Bodybuilding peptide cjc 1295/cjc dac 1295 Place of Origin: Guangdong,China (Mainland) Brand Name: Kirobiotech Purity: >98% appearance: White powder Certificate: ...

    Kirobiotech Co., Ltd
    ICP Remarked Supplier

    Wholesale CJC-1295 DAC , CJC-1295 with DAC |  	Peptide - Forever-Inject.cc Online Store | CJC1295/DAC , CJC1295 with DAC from china suppliers

    Place of Origin:China

    Brand Name:Forever-Inject.cc

    Model Number:2mg/vial

    ...CJC-1295 with DAC, a long acting GHRH polypeptide, causes the anterior pituitary's somatotropes to release growth horm. DAC conjugated CJC-1295, makes this GHRH have a half life of more than a week (approx.8 days). GHRH peptides is...

    ForeverInject International Holdings CO. Limited
    Site Member

    Zhejiang

    Wholesale CJC-1295 DAC , Peptide , Synonyms : CJC1295/DAC , CJC1295 with DAC from china suppliers

    Place of Origin:Forever-Inject.cc

    Brand Name:Forever-Inject

    ...CJC-1295 DAC,2mg a long acting GHRH polypeptide, causes the anterior pituitary's somatotropes to release growth horm one. DAC conjugated CJC-1295, makes this GHRH have a half life of more than a week (approx.8 days). GHRH peptides...

    ForeverInject International Holdings CO. Limited
    Site Member

    Zhejiang

    Wholesale BodyBuilding Peptide Cjc 1295 Dac Peptides Increases Protein Synthesis Powder from china suppliers

    Brand Name:CJC-1295 ( DAC)

    Model Number:CJC-1295 ( DAC)

    Place of Origin:china

    ... gland and is released in a pulsatile manner to ultimately stimulate pulsatile release of growth hormone. CJC-1295 DAC which

    Beijing Xin-run KangYi Technology Development Co.,lTD
    Active Member

    Inquiry Cart 0