Sign In | Join Free | My xpandrally.com
xpandrally.com
Products
Search by Category
Home > Chemicals > Chemical Product Agents >

Whats A Peptide

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    whats a peptide

    All whats a peptide wholesalers & whats a peptide manufacturers come from members. We doesn't provide whats a peptide products or service, please contact them directly and verify their companies info carefully.

    Total 43767 products from whats a peptide Manufactures & Suppliers
    Wholesale High Quality Peptides Hexarelin CAS: 140703-51-1 for Muscle Building from china suppliers

    Brand Name:shinrezing

    Model Number:140703-51-1

    Place of Origin:China

    .../vail Usage Hexarelin is becoming a popular choice as a performance enhancement drug Description Hexarelin (HEX) is a peptide G-H secretagogue, structurally similar to GHRP-6,

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale 2mg/vial Freeze Dried White Powder Peptides Hormones PEG-MGF For Muscle Gaining from china suppliers

    Brand Name:LSW

    Model Number:PEG-MGF

    Place of Origin:China

    ...2mg/vial High Purity Freeze-Dried White Powder Peptides Hormones PEG-MGF For Muscle Gaining Product Description: Mechano Growth Factor (MGF) also known as ...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale 2mg / Vial Human Peptides Fat Loss Steroids Frag Fragment 99% Min Assay from china suppliers

    Brand Name:HongKong Blue

    Model Number:CAS: 221231-10-3

    Place of Origin:China

    ...mg/vial Human Growth Peptides Fat Loss Steroids Frag Fragment 176-191 HGH Fragment 176-191 CAS No.: 221231-10-3 ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale Bodybuilding Delta Sleep-inducing steroid Raw Peptide 62568-57-4 DSIP 2mg from china suppliers

    Brand Name:YIHAN

    Model Number:62568-57-4

    Place of Origin:CHINA

    ...-729-3 Purity 99.50% Apprarance White powder. Specification 2mg/vial Grade Pharmaceutical Grade Storage Lyophilized peptides although stable at room temperature for 3 months, should, be stored desiccated below

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Wholesale Igtropin IGF LR3 -1 Human Growth Peptides HGH Healthy For Gaining Muscle from china suppliers

    Brand Name:Pharma Grade

    Model Number:946870-92-4

    Place of Origin:Zhejiang,China

    Igtropin IGF LR3 -1 hgh Healthy For Gaining Muscle Product main information: Protuct Name: IGF LR3 -1 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place Grade:Medicine Grad Specification:1mg/vial 10vials/kit Supply Ability:...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Sell 99% Anti Aging Peptides PT-7 / Palmitoyl Tetrapeptide-7 Powder CAS:221227-05-0 from china suppliers

    Brand Name:Kafen

    Model Number:221227-05-0

    Place of Origin:China

    ...) :≤15.0% Amino Acid Composition :±10% of theoretical Purity(by HPLC) :≥90.0% Single Impurity(by HPLC) :≤2.0% Peptide Content(by %N ) :≥80% Assay(By Anhydrous, Acetic Acid-free ) :95.0~105.0% Bacterial Endotoxins :≤10EU/mg...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale FOXO4 DRI Peptide APIs Anti Aging Peptides 10mg Vials Quality Guarantee from china suppliers

    Brand Name:MOBELBIO

    Place of Origin:CHINA

    ...-DRI / Senolytics with 98% min For anti-aging and longevity FOXO4 D-Retro-Inverso(DRI) peptide MS/HPLC Reports MS Report HPLC Report Quantity/Unit 1 Vial Sequence H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH Three letter ...

    HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD
    Verified Supplier

    Zhejiang

    Wholesale Bodybuilding Peptide Hormones Ipamorelin 2mg Per Vial  For Muscle Growth from china suppliers

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    ...Bodybuilding Peptide Hormones Ipamorelin 2mg Per Vial For Muscle Growth Ipamorelin Quick Detail : Product Name: Ipamorelin Unit ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale Ghrp-6 Human Growth Hormone Peptide For Muscle Gaining CAS 87616-84-0 from china suppliers

    Brand Name:Pharmlab

    Model Number:87616-84-0

    Place of Origin:China

    ... Muscle Gaining CAS 87616-84-0 Quick detail Product Name: GHRP-6 Chemical Name: Growth hormon releasing peptide-6 CAS Number: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 specification;5mg/vail *10vial...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Material Peptide Pentadecapeptide Bpc 157 CAS 137525-51-0 2mg vial for Healing from china suppliers

    Brand Name:JNJG

    Model Number:137525-51-0

    Place of Origin:CHINA

    ...Material Peptide Pentadecapeptide Bpc 157 CAS 137525-51-0 2mg vial for Healing Pentadecapeptide Bpc 157 Specification: Product ...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale Thymosin Alpha1 Acetate Growth Peptides Bodybuilding 10mg / vial CAS 62304-98-7 from china suppliers

    Brand Name:Sendi

    Model Number:Thymosin α1 Acetate

    Place of Origin:China

    ...Thymosin Alpha1 Acetate Growth Peptides Bodybuilding 10mg / vial CAS 62304-98-7 10mg/vial MOQ: 10 vials Payment: T/T, Western Union, MoneyGram, ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale Pharmaceutical Human Growth Peptides Ghrp-6 5mg / Vial 10mg / Vial CAS 87616-84-0 from china suppliers

    Brand Name:YC

    Model Number:87616-84-0

    Place of Origin:China

    ...: White powder Grade : Pharmaceutical Grade Storage: Closed, below 2 ~ 8℃ preservation General Information Growth Hormone Releasing Peptide-6 or GHRP-6 is basically a hgH secretagoue, which has the potential to facilitate the

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale Factory Price High Purity Lyophilized Peptide Gonadorelin CAS: 33515-09-2 For infertility Treatment Lyophilized Powder from china suppliers

    Brand Name:TINGYI

    Model Number:CAS: 33515-09-2

    Place of Origin:China

    ... 33515-09-2 M.F. C55-H75-N17-O13 M.W. 1182 Assay 98% Appearance White Lyophilized Powder Storage Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18 C. Upon reconstitution...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier

    Chongqing

    Wholesale Anti-Aging Protein Peptide Hormones Epitalon Peptide Powder Effect Dosage and Uses 307297-39-8 from china suppliers

    Brand Name:Muscle Man

    Model Number:CAS: 307297-39-8

    Place of Origin:Hunan,China

    ...Anti-Aging Protein Peptide Hormones Epitalon Peptide Powde Effect Dosage and Uses 307297-39-8 Basic information: Product name Epitalon Purity 99% Apperance ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Wholesale Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results from china suppliers

    Brand Name:coco@yuanchengtech.com

    Model Number:106612-94-6

    Place of Origin:China

    ...Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results Wuhan Lianshangwang Technology Co.,LTD Contact person:helena liu ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hubei

    Wholesale Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 from china suppliers

    Brand Name:YIHAN

    Model Number:IGF-1 LR3

    Place of Origin:CHINA

    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS No.:...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale High Purity 98% Peptides Steroids Trenbolone Acetate Powder CAS 10161-34-9 from china suppliers

    Brand Name:Rund

    Model Number:10161-34-9

    Place of Origin:China

    Steroid hormone Yellow Crystalline Raw Steroid Powders Trenbolone Acetate CAS 10161-34-9 High Purity 98% Quick Details: Product name: Trenbolone Acetate Alias: Revalor-H; Finaplix; 17-beta-acetoxy-delta-4,9,11-estratrien-3-one; Tren A, Finajet CAS No: ...

    3M Biotech Co., Ltd
    Verified Supplier

    Wholesale Raw Cosmetic Ingredients Copper Peptide GHK-CU Powder 99% CAS 49557-75-7 from china suppliers

    Brand Name:Forest Like

    Model Number:98%

    Place of Origin:China Mainland

    ...Cosmetic Grade Copper Peptide GHK-CU Powder 99% CAS 49557-75-7 Description Copper peptide products are used for wound healing (Iamin, BioHeal),skin renewal (Blue Copper, Neova, Neutrogena copper, P&R), ...

    Xi\'an Fu Ke Commerce & Trading Co., Ltd.
    Verified Supplier

    Wholesale Melanotan II 10mg/Vial Polypeptide Hormones Bodybuilding Fat Burning Peptides from china suppliers

    Brand Name:YUANHANG

    Model Number:Melanotan II 10mg/vial

    Place of Origin:CHINA

    ... Gaining Strength Origin: China HS Code: 293729002 Melanotan may refer to one of two separate peptides : Afamelanotide, originally developed under

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale ghrp-2 , GHRP2 | Peptide - Forever-Inject.cc Online Store | Synonyms | Growth Horm one Releasing Peptide 2 , ghrp2 from china suppliers

    Place of Origin:China

    Brand Name:Forever-Inject.cc

    Model Number:5mg

    ...GHRP2 5.0mg GHRP-2 (Growth Hor Releasing Peptide 2) substantially stimulates the pituitary gland's increased natural production of the body's own endogenous human growth ...

    ForeverInject International Holdings CO. Limited
    Site Member

    Zhejiang

    Inquiry Cart 0